![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (57 families) ![]() |
![]() | Family c.66.1.34: mRNA cap (Guanine N-7) methyltransferase [102560] (1 protein) mRNA capping enzyme |
![]() | Protein mRNA cap (Guanine N-7) methyltransferase [102561] (1 species) |
![]() | Species Fungus (Encephalitozoon cuniculi) [TaxId:6035] [102562] (7 PDB entries) |
![]() | Domain d1z3ca1: 1z3c A:41-292 [124398] automatically matched to d1ri1a_ complexed with sa8 |
PDB Entry: 1z3c (more details), 2.2 Å
SCOP Domain Sequences for d1z3ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z3ca1 c.66.1.34 (A:41-292) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} sktinirnannfikaclirlytkrgdsvldlgcgkggdllkyeragigeyygvdiaevsi ndarvrarnmkrrfkvffraqdsygrhmdlgkefdvissqfsfhyafstsesldiaqrni arhlrpggyfimtvpsrdvilerykqgrmsndfykielekmedvpmesvreyrftlldsv nncieyfvdftrmvdgfkrlglslverkgfidfyedegrrnpelskkmglgcltreesev vgiyevvvfrkl
Timeline for d1z3ca1: