SCOPe 2.08: Domain d1z2ua1: 1z2u A:1-147

Lineage for d1z2ua1 (1z2u A:1-147)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)

7. Species Caenorhabditis elegans, E2 2 [TaxId:6239] [143060] (1 PDB entry)
   Uniprot P35129 1-147

8. Domain d1z2ua1: 1z2u A:1-147 [124389]
   Other proteins in same PDB: d1z2ua2
   complexed with bu3, cl, na, unx

Details for d1z2ua1

PDB Entry: 1z2u, 1.1 Å

PDB Description: the 1.1a crystallographic structure of ubiquitin-conjugating enzyme (ubc-2) from caenorhabditis elegans: functional and evolutionary significance

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 2

SCOPe Domain Sequences for d1z2ua1:

Sequence; same for both SEQRES and ATOM records:

>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]}
malkriqkelqdlgrdppaqcsagpvgddlfhwqatimgppespyqggvffltihfptdy
pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv
peiariyktdrerynqlarewtqkyam

Timeline for d1z2ua1:

• d1z2ua1 first appeared in SCOP 1.73
  
• d1z2ua1 appears in SCOPe 2.07