SCOP 1.73: Domain d1z2lb1: 1z2l B:4-212,B:330-412

Lineage for d1z2lb1 (1z2l B:4-212,B:330-412)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (8 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (17 proteins)

6. Protein Allantoate amidohydrolase AllC catalytic domain [142514] (1 species)

7. Species Escherichia coli [TaxId:562] [142515] (2 PDB entries)

8. Domain d1z2lb1: 1z2l B:4-212,B:330-412 [124385]
   Other proteins in same PDB: d1z2la2, d1z2lb2
   automatically matched to 1Z2L A:4-212,A:330-413
   complexed with 1al, so4, zn

Details for d1z2lb1

PDB Entry: 1z2l, 2.25 Å

PDB Description: crystal structure of allantoate-amidohydrolase from e.coli k12 in complex with substrate allantoate

PDB Compounds: (B:) Allantoate amidohydrolase

SCOP Domain Sequences for d1z2lb1:

Sequence; same for both SEQRES and ATOM records:

>d1z2lb1 c.56.5.4 (B:4-212,B:330-412) Allantoate amidohydrolase AllC catalytic domain {Escherichia coli [TaxId: 562]}
ithfrqaieetlpwlssfgadpaggmtrllyspewletqqqfkkrmaasgletrfdevgn
lygrlngteypqevvlsgshidtvvnggnldgqfgalaawlaidwlktqygaplrtvevv
amaeeegsrfpyvfwgsknifglanpddvrnicdakgnsfvdamkacgftlpnapltprq
dikafvelhieqgcvlesngqsigvvnaiXvpmnkelvatltelcereklnyrvmhsgag
hdaqifaprvptcmifipsingishnpaertnitdlaegvktlalmlyqlawq

Timeline for d1z2lb1:

• d1z2lb1 is new in SCOP 1.73
  
• d1z2lb1 appears in SCOP 1.75
  
• d1z2lb1 appears in the current release, SCOPe 2.08