Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein RhoC [142245] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142246] (3 PDB entries) Uniprot P08134 1-179 |
Domain d1z2cc_: 1z2c C: [124378] Other proteins in same PDB: d1z2cb1, d1z2cd_ automated match to d4f38a_ complexed with gnp, mg |
PDB Entry: 1z2c (more details), 3 Å
SCOPe Domain Sequences for d1z2cc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z2cc_ c.37.1.8 (C:) RhoC {Human (Homo sapiens) [TaxId: 9606]} maairkklvivgdgacgktcllivnskdqfpevyvptvfenyiadievdgkqvelalwdt agqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkd lrqdehtrrelakmkqepvrseegrdmanrisafgylecsaktkegvrevfematragl
Timeline for d1z2cc_: