Lineage for d1z2cc_ (1z2c C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846830Protein RhoC [142245] (1 species)
  7. 1846831Species Human (Homo sapiens) [TaxId:9606] [142246] (3 PDB entries)
    Uniprot P08134 1-179
  8. 1846836Domain d1z2cc_: 1z2c C: [124378]
    Other proteins in same PDB: d1z2cb1, d1z2cd_
    automated match to d4f38a_
    complexed with gnp, mg

Details for d1z2cc_

PDB Entry: 1z2c (more details), 3 Å

PDB Description: crystal structure of mdia1 gbd-fh3 in complex with rhoc-gmppnp
PDB Compounds: (C:) Rho-related GTP-binding protein RhoC

SCOPe Domain Sequences for d1z2cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z2cc_ c.37.1.8 (C:) RhoC {Human (Homo sapiens) [TaxId: 9606]}
maairkklvivgdgacgktcllivnskdqfpevyvptvfenyiadievdgkqvelalwdt
agqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkd
lrqdehtrrelakmkqepvrseegrdmanrisafgylecsaktkegvrevfematragl

SCOPe Domain Coordinates for d1z2cc_:

Click to download the PDB-style file with coordinates for d1z2cc_.
(The format of our PDB-style files is described here.)

Timeline for d1z2cc_: