SCOPe 2.05: Domain d1z2aa_: 1z2a A:

Lineage for d1z2aa_ (1z2a A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186847] (9 PDB entries)

8. Domain d1z2aa_: 1z2a A: [124374]
   automated match to d1vg9f_
   complexed with gdp, mg

Details for d1z2aa_

PDB Entry: 1z2a, 1.9 Å

PDB Description: GDP-Bound Rab23 GTPase crystallized in P2(1)2(1)2(1) space group

PDB Compounds: (A:) Ras-related protein Rab-23

SCOPe Domain Sequences for d1z2aa_:

Sequence; same for both SEQRES and ATOM records:

>d1z2aa_ c.37.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vaikmvvvgngavgkssmiqryckgiftkdykktigvdflerqiqvndedvrlmlwdtag
qeefdaitkayyrgaqacvlvfsttdresfeaisswrekvvaevgdiptalvqnkidlld
dscikneeaeglakrlklrfyrtsvkedlnvsevfkylaekhlq

Timeline for d1z2aa_:

• d1z2aa_ first appeared in SCOP 1.73, called d1z2aa1
  
• d1z2aa_ appears in SCOPe 2.04
  
• d1z2aa_ appears in SCOPe 2.06
  
• d1z2aa_ appears in the current release, SCOPe 2.08