SCOP 1.73: Domain d1z2aa1: 1z2a A:8-171

Lineage for d1z2aa1 (1z2a A:8-171)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab23 [142231] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [142232] (2 PDB entries)

8. Domain d1z2aa1: 1z2a A:8-171 [124374]
   automatically matched to 1Z22 A:8-171
   complexed with gdp, mg

Details for d1z2aa1

PDB Entry: 1z2a, 1.9 Å

PDB Description: GDP-Bound Rab23 GTPase crystallized in P2(1)2(1)2(1) space group

PDB Compounds: (A:) Ras-related protein Rab-23

SCOP Domain Sequences for d1z2aa1:

Sequence; same for both SEQRES and ATOM records:

>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]}
vaikmvvvgngavgkssmiqryckgiftkdykktigvdflerqiqvndedvrlmlwdtag
qeefdaitkayyrgaqacvlvfsttdresfeaisswrekvvaevgdiptalvqnkidlld
dscikneeaeglakrlklrfyrtsvkedlnvsevfkylaekhlq

Timeline for d1z2aa1:

• d1z2aa1 is new in SCOP 1.73
  
• d1z2aa1 appears in SCOP 1.75
  
• d1z2aa1 appears in the current release, SCOPe 2.08, called d1z2aa_