SCOPe 2.01: Domain d1z1bb1: 1z1b B:11-59

Lineage for d1z1bb1 (1z1b B:11-59)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.10: DNA-binding domain [54170] (1 superfamily)
   beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.10.1: DNA-binding domain [54171] (4 families)

5. Family d.10.1.4: lambda integrase N-terminal domain [75344] (1 protein)

6. Protein lambda integrase N-terminal domain [75345] (1 species)

7. Species Bacteriophage lambda [TaxId:10710] [75346] (3 PDB entries)

8. Domain d1z1bb1: 1z1b B:11-59 [124348]
   Other proteins in same PDB: d1z1ba2, d1z1bb2
   automatically matched to d1kjka_
   protein/DNA complex

Details for d1z1bb1

PDB Entry: 1z1b, 3.8 Å

PDB Description: crystal structure of a lambda integrase dimer bound to a coc' core site

PDB Compounds: (B:) integrase

SCOPe Domain Sequences for d1z1bb1:

Sequence; same for both SEQRES and ATOM records:

>d1z1bb1 d.10.1.4 (B:11-59) lambda integrase N-terminal domain {Bacteriophage lambda [TaxId: 10710]}
dlppnlyirnngyycyrdprtgkefglgrdrriaiteaiqanielfsgh

Timeline for d1z1bb1:

• d1z1bb1 first appeared in SCOP 1.73
  
• d1z1bb1 appears in SCOP 1.75
  
• d1z1bb1 appears in SCOPe 2.02
  
• d1z1bb1 appears in the current release, SCOPe 2.08