Class a: All alpha proteins [46456] (284 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.19: Rabenosyn-5 Rab-binding domain-like [140125] (1 family) |
Family a.2.19.1: Rabenosyn-5 Rab-binding domain-like [140126] (2 proteins) |
Protein automated matches [190845] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188164] (1 PDB entry) |
Domain d1z0kd_: 1z0k D: [124324] Other proteins in same PDB: d1z0ka1, d1z0kb1, d1z0kc_ automated match to d1z0kb1 complexed with gtp, mes, mg |
PDB Entry: 1z0k (more details), 1.92 Å
SCOPe Domain Sequences for d1z0kd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z0kd_ a.2.19.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} egwlplsggqgqsedsdpllqqihnitsfirqakaagrmdevrtlqenlrqlqdeydqqq t
Timeline for d1z0kd_: