SCOP 1.75: Domain d1z0kc1: 1z0k C:5-172

Lineage for d1z0kc1 (1z0k C:5-172)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab4a [142247] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142248] (4 PDB entries)
   Uniprot P20338 2-172! Uniprot P20338 4-172! Uniprot P20338 4-184

8. Domain d1z0kc1: 1z0k C:5-172 [124323]
   Other proteins in same PDB: d1z0kb1, d1z0kd1
   automatically matched to 1Z0K A:4-172
   complexed with gtp, mes, mg

Details for d1z0kc1

PDB Entry: 1z0k, 1.92 Å

PDB Description: structure of gtp-bound rab4q67l gtpase in complex with the central rab binding domain of rabenosyn-5

PDB Compounds: (C:) GTP-binding protein

SCOP Domain Sequences for d1z0kc1:

Sequence; same for both SEQRES and ATOM records:

>d1z0kc1 c.37.1.8 (C:5-172) Rab4a {Human (Homo sapiens) [TaxId: 9606]}
ydflfkflvignagtgkscllhqfiekkfkddsnhtigvefgskiinvggkyvklqiwdt
aglerfrsvtrsyyrgaagallvyditsretynaltnwltdarmlasqniviilcgnkkd
ldadrevtfleasrfaqenelmfletsaltgedveeafvqcarkilnk

Timeline for d1z0kc1:

• d1z0kc1 first appeared in SCOP 1.73
  
• d1z0kc1 is called d1z0kc_ in SCOPe 2.01
  
• d1z0kc1 appears in the current release, SCOPe 2.08, called d1z0kc_