Lineage for d1z0hb1 (1z0h B:862-1079)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663960Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (2 proteins)
  6. 663961Protein Botulinum neurotoxin [49959] (2 species)
  7. 663964Species Clostridium botulinum, serotype B [TaxId:1491] [49961] (16 PDB entries)
  8. 663972Domain d1z0hb1: 1z0h B:862-1079 [124316]
    Other proteins in same PDB: d1z0ha2, d1z0hb2
    automatically matched to d1epwa1

Details for d1z0hb1

PDB Entry: 1z0h (more details), 2 Å

PDB Description: N-terminal helix reorients in recombinant C-fragment of Clostridium botulinum type B
PDB Compounds: (B:) botulinum neurotoxin type b

SCOP Domain Sequences for d1z0hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z0hb1 b.29.1.6 (B:862-1079) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]}
niilnlrykdnnlidlsgygakvevydgvelndknqfkltssanskirvtqnqniifnsv
fldfsvsfwiripkykndgiqnyihneytiincmknnsgwkisirgnriiwtlidingkt
ksvffeynirediseyinrwffvtitnnlnnakiyingklesntdikdireviangeiif
kldgdidrtqfiwmkyfsifntelsqsnieerykiqsy

SCOP Domain Coordinates for d1z0hb1:

Click to download the PDB-style file with coordinates for d1z0hb1.
(The format of our PDB-style files is described here.)

Timeline for d1z0hb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z0hb2