SCOPe 2.04: Domain d1z0fa_: 1z0f A:

Lineage for d1z0fa_ (1z0f A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (79 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (95 PDB entries)

8. Domain d1z0fa_: 1z0f A: [124313]
   automated match to d1oiva_
   complexed with gdp, mg

Details for d1z0fa_

PDB Entry: 1z0f, 2.15 Å

PDB Description: GDP-Bound Rab14 GTPase

PDB Compounds: (A:) RAB14, member RAS oncogene family

SCOPe Domain Sequences for d1z0fa_:

Sequence; same for both SEQRES and ATOM records:

>d1z0fa_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nysyifkyiiigdmgvgkscllhqftekkfmadcphtigvefgtriievsgqkiklqiwd
tagqerfravtrsyyrgaagalmvyditrrstynhlsswltdarnltnpntviilignka
dleaqrdvtyeeakqfaeengllfleasaktgenvedafleaakkiy

Timeline for d1z0fa_:

• d1z0fa_ first appeared in SCOP 1.73, called d1z0fa1
  
• d1z0fa_ appears in SCOPe 2.03
  
• d1z0fa_ appears in SCOPe 2.05
  
• d1z0fa_ appears in the current release, SCOPe 2.08