SCOPe 2.06: Domain d1z0ac_: 1z0a C:

Lineage for d1z0ac_ (1z0a C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (124 PDB entries)

8. Domain d1z0ac_: 1z0a C: [124309]
   Other proteins in same PDB: d1z0aa1
   automated match to d1oiva_
   complexed with gdp, mg

Details for d1z0ac_

PDB Entry: 1z0a, 2.12 Å

PDB Description: GDP-Bound Rab2A GTPase

PDB Compounds: (C:) Ras-related protein Rab-2A

SCOPe Domain Sequences for d1z0ac_:

Sequence; same for both SEQRES and ATOM records:

>d1z0ac_ c.37.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ayaylfkyiiigdtgvgksclllqftdkrfqpvhdltigvefgarmitidgkqiklqiwd
tagqesfrsitrsyyrgaagallvyditrrdtfnhlttwledarqhsnsnmvimlignks
dlesrrevkkeegeafarehglifmetsaktasnveeafintakeiyek

Timeline for d1z0ac_:

• d1z0ac_ first appeared in SCOP 1.73, called d1z0ac1
  
• d1z0ac_ appears in SCOPe 2.05
  
• d1z0ac_ appears in SCOPe 2.07
  
• d1z0ac_ appears in the current release, SCOPe 2.08