Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rab5c [52603] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [52604] (3 PDB entries) |
Domain d1z07a1: 1z07 A:19-182 [124302] complexed with gnp, mg; mutant |
PDB Entry: 1z07 (more details), 1.81 Å
SCOP Domain Sequences for d1z07a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z07a1 c.37.1.8 (A:19-182) Rab5c {Mouse (Mus musculus) [TaxId: 10090]} icqfklvllgesavgksslvlrfvkgqfheyqestiqaafltqtvclddttvkfeiwdta gqeryhslapmyyrgaqaaivvyditntdtfaraknwvkelqrqaspnivialagnkadl askravefqeaqayaddnsllfmetsaktamnvneifmaiakkl
Timeline for d1z07a1: