SCOPe 2.03: Domain d1z06a1: 1z06 A:32-196

Lineage for d1z06a1 (1z06 A:32-196)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab-33b [142279] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [142280] (2 PDB entries)
   Uniprot O35963 32-196

8. Domain d1z06a1: 1z06 A:32-196 [124301]
   complexed with gnp, mg

Details for d1z06a1

PDB Entry: 1z06, 1.81 Å

PDB Description: GppNHp-Bound Rab33 GTPase

PDB Compounds: (A:) Ras-related protein Rab-33B

SCOPe Domain Sequences for d1z06a1:

Sequence; same for both SEQRES and ATOM records:

>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]}
rifkiivigdsnvgktcltyrfcagrfpdrteatigvdfreravdidgerikiqlwdtag
qerfrksmvqhyyrnvhavvfvydmtnmasfhslpawieeckqhllandiprilvgnkcd
lrsaiqvptdlaqkfadthsmplfetsaknpndndhveaifmtla

Timeline for d1z06a1:

• d1z06a1 first appeared in SCOP 1.73
  
• d1z06a1 appears in SCOPe 2.02
  
• d1z06a1 appears in SCOPe 2.04
  
• d1z06a1 appears in the current release, SCOPe 2.08