Lineage for d1yztb1 (1yzt B:17-183)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695634Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 696095Protein Rab21 [142285] (1 species)
  7. 696096Species Human (Homo sapiens) [TaxId:9606] [142286] (4 PDB entries)
  8. 696102Domain d1yztb1: 1yzt B:17-183 [124289]
    automatically matched to 1YZT A:17-183
    complexed with gnp, mg

Details for d1yztb1

PDB Entry: 1yzt (more details), 2.05 Å

PDB Description: GppNHp-Bound Rab21 GTPase at 2.05 A Resolution
PDB Compounds: (B:) Ras-related protein Rab-21

SCOP Domain Sequences for d1yztb1:

Sequence, based on SEQRES records: (download)

>d1yztb1 c.37.1.8 (B:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]}
aysfkvvllgegcvgktslvlrycenkfndkhittlqasfltkklniggkrvnlaiwdta
gqerfhalgpiyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnkidl
ekerhvsiqeaesyaesvgakhyhtsakqnkgieelfldlckrmiet

Sequence, based on observed residues (ATOM records): (download)

>d1yztb1 c.37.1.8 (B:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]}
aysfkvvllgegcvgktslvlrycenkfndkhittlqasfltkklniggkrvnlaiwdta
rdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnkidlekerhvsiqeaes
yaesvgakhyhtsakqnkgieelfldlckrmiet

SCOP Domain Coordinates for d1yztb1:

Click to download the PDB-style file with coordinates for d1yztb1.
(The format of our PDB-style files is described here.)

Timeline for d1yztb1: