SCOPe 2.06: Domain d1yzna2: 1yzn A:3-172

Lineage for d1yzna2 (1yzn A:3-172)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab11a [102362] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159558] (2 PDB entries)

8. Domain d1yzna2: 1yzn A:3-172 [124284]
   Other proteins in same PDB: d1yzna3
   automated match to d2d7ca_
   complexed with gnp, mg

Details for d1yzna2

PDB Entry: 1yzn, 2.06 Å

PDB Description: GppNHp-Bound Ypt1p GTPase

PDB Compounds: (A:) GTP-binding protein YPT1

SCOPe Domain Sequences for d1yzna2:

Sequence; same for both SEQRES and ATOM records:

>d1yzna2 c.37.1.8 (A:3-172) Rab11a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
seydylfklllignsgvgksclllrfsddtytndyistigvdfkiktveldgktvklqiw
dtagqerfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstvlkllvgnk
cdlkdkrvveydvakefadankmpfletsaldstnvedafltmarqikes

Timeline for d1yzna2:

• d1yzna2 first appeared in SCOP 1.73, called d1yzna1
  
• d1yzna2 was called d1yzna_ in SCOPe 2.05
  
• d1yzna2 appears in SCOPe 2.07
  
• d1yzna2 appears in the current release, SCOPe 2.08