SCOPe 2.05: Domain d1yzna_: 1yzn A:

Lineage for d1yzna_ (1yzn A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab11a [102362] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159558] (2 PDB entries)

8. Domain d1yzna_: 1yzn A: [124284]
   automated match to d2d7ca_
   complexed with gnp, mg

Details for d1yzna_

PDB Entry: 1yzn, 2.06 Å

PDB Description: GppNHp-Bound Ypt1p GTPase

PDB Compounds: (A:) GTP-binding protein YPT1

SCOPe Domain Sequences for d1yzna_:

Sequence; same for both SEQRES and ATOM records:

>d1yzna_ c.37.1.8 (A:) Rab11a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hgslvprgseydylfklllignsgvgksclllrfsddtytndyistigvdfkiktveldg
ktvklqiwdtagqerfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstv
lkllvgnkcdlkdkrvveydvakefadankmpfletsaldstnvedafltmarqikes

Timeline for d1yzna_:

• d1yzna_ first appeared in SCOP 1.73, called d1yzna1
  
• d1yzna_ appears in SCOPe 2.04
  
• d1yzna_ is called d1yzna2 in SCOPe 2.06
  
• d1yzna_ appears in the current release, SCOPe 2.08, called d1yzna2