![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Rab11a [102362] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102363] (9 PDB entries) |
![]() | Domain d1yzna1: 1yzn A:4-169 [124284] automatically matched to d1oiva_ complexed with gnp, mg |
PDB Entry: 1yzn (more details), 2.06 Å
SCOP Domain Sequences for d1yzna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yzna1 c.37.1.8 (A:4-169) Rab11a {Human (Homo sapiens) [TaxId: 9606]} eydylfklllignsgvgksclllrfsddtytndyistigvdfkiktveldgktvklqiwd tagqerfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstvlkllvgnkc dlkdkrvveydvakefadankmpfletsaldstnvedafltmarqi
Timeline for d1yzna1: