Class a: All alpha proteins [46456] (258 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (22 species) |
Species Human (Homo sapiens) [TaxId:9606] [46501] (173 PDB entries) |
Domain d1yzib1: 1yzi B:1-146 [124280] Other proteins in same PDB: d1yzia1 automatically matched to d1dxtb_ complexed with cmo, hem, mbn |
PDB Entry: 1yzi (more details), 2.07 Å
SCOP Domain Sequences for d1yzib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yzib1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]} vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk eftppvqaayqkvvagvanalahkyh
Timeline for d1yzib1: