Lineage for d1yywd2 (1yyw D:151-220)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946839Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2946840Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2946841Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
    Pfam PF00035
  6. 2946868Protein RNase III, C-terminal domain [54776] (3 species)
  7. 2946869Species Aquifex aeolicus [TaxId:63363] [102927] (9 PDB entries)
  8. 2946886Domain d1yywd2: 1yyw D:151-220 [124263]
    Other proteins in same PDB: d1yywa1, d1yywb1, d1yywc1, d1yywd1
    automated match to d2nugb2
    protein/RNA complex

Details for d1yywd2

PDB Entry: 1yyw (more details), 2.8 Å

PDB Description: Crystal structure of RNase III from Aquifex aeolicus complexed with double stranded RNA at 2.8-Angstrom Resolution
PDB Compounds: (D:) Ribonuclease III

SCOPe Domain Sequences for d1yywd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yywd2 d.50.1.1 (D:151-220) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
dyktilqeitqkrwkerpeyrlisvegphhkkkfiveakikeyrtlgegkskkeaeqraa
eelikllees

SCOPe Domain Coordinates for d1yywd2:

Click to download the PDB-style file with coordinates for d1yywd2.
(The format of our PDB-style files is described here.)

Timeline for d1yywd2: