SCOP 1.73: Domain d1yylr2: 1yyl R:1114-1214

Lineage for d1yylr2 (1yyl R:1114-1214)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1yylr2: 1yyl R:1114-1214 [124231]
   Other proteins in same PDB: d1yylg1, d1yylh1, d1yyll1, d1yyll2, d1yylp1, d1yylq1, d1yylq2, d1yylr1
   automatically matched to d1ngzb2
   complexed with bif, mpt, nag, ndg, vlm; mutant

Details for d1yylr2

PDB Entry: 1yyl, 2.75 Å

PDB Description: crystal structure of cd4m33, a scorpion-toxin mimic of cd4, in complex with hiv-1 yu2 gp120 envelope glycoprotein and anti-hiv-1 antibody 17b

PDB Compounds: (R:) Antibody 17B Heavy chain

SCOP Domain Sequences for d1yylr2:

Sequence; same for both SEQRES and ATOM records:

>d1yylr2 b.1.1.2 (R:1114-1214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Timeline for d1yylr2:

• d1yylr2 is new in SCOP 1.73
  
• d1yylr2 appears in SCOP 1.75
  
• d1yylr2 appears in the current release, SCOPe 2.08