SCOPe 2.01: Domain d1yy9a3: 1yy9 A:163-311

Lineage for d1yy9a3 (1yy9 A:163-311)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.9: Growth factor receptor domain [57184] (1 family)

5. Family g.3.9.1: Growth factor receptor domain [57185] (9 proteins)

6. Protein EGF receptor Cys-rich domains [82887] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82888] (6 PDB entries)

8. Domain d1yy9a3: 1yy9 A:163-311 [124209]
   Other proteins in same PDB: d1yy9a1, d1yy9a2
   automatically matched to d1ivoa3
   complexed with nag, ndg

Details for d1yy9a3

PDB Entry: 1yy9, 2.6 Å

PDB Description: structure of the extracellular domain of the epidermal growth factor receptor in complex with the fab fragment of cetuximab/erbitux/imc- c225

PDB Compounds: (A:) Epidermal growth factor receptor

SCOPe Domain Sequences for d1yy9a3:

Sequence; same for both SEQRES and ATOM records:

>d1yy9a3 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]}
cqkcdpscpngscwgageencqkltkiicaqqcsgrcrgkspsdcchnqcaagctgpres
dclvcrkfrdeatckdtcpplmlynpttyqmdvnpegkysfgatcvkkcprnyvvtdhgs
cvracgadsyemeedgvrkckkcegpcrk

Timeline for d1yy9a3:

• d1yy9a3 first appeared in SCOP 1.73
  
• d1yy9a3 appears in SCOP 1.75
  
• d1yy9a3 appears in SCOPe 2.02
  
• d1yy9a3 appears in the current release, SCOPe 2.08