Lineage for d1yy9a2 (1yy9 A:312-480)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459922Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2459991Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2460079Family c.10.2.5: L domain [52071] (6 proteins)
    this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain
  6. 2460080Protein EGF receptor extracellular domain [82326] (1 species)
  7. 2460081Species Human (Homo sapiens) [TaxId:9606] [82327] (7 PDB entries)
  8. 2460084Domain d1yy9a2: 1yy9 A:312-480 [124208]
    Other proteins in same PDB: d1yy9a3, d1yy9a4, d1yy9a5, d1yy9c1, d1yy9c2
    automatically matched to d1ivoa2
    complexed with nag, ndg

Details for d1yy9a2

PDB Entry: 1yy9 (more details), 2.6 Å

PDB Description: structure of the extracellular domain of the epidermal growth factor receptor in complex with the fab fragment of cetuximab/erbitux/imc- c225
PDB Compounds: (A:) Epidermal growth factor receptor

SCOPe Domain Sequences for d1yy9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yy9a2 c.10.2.5 (A:312-480) EGF receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
vcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeldil
ktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrslke
isdgdviisgnknlcyantinwkklfgtsgqktkiisnrgenkckatgq

SCOPe Domain Coordinates for d1yy9a2:

Click to download the PDB-style file with coordinates for d1yy9a2.
(The format of our PDB-style files is described here.)

Timeline for d1yy9a2: