SCOPe 2.07: Domain d1yy9a1: 1yy9 A:6-162

Lineage for d1yy9a1 (1yy9 A:6-162)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.5: L domain [52071] (6 proteins)
   this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain

6. Protein EGF receptor extracellular domain [82326] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82327] (7 PDB entries)

8. Domain d1yy9a1: 1yy9 A:6-162 [124207]
   Other proteins in same PDB: d1yy9a3, d1yy9a4, d1yy9a5, d1yy9c1, d1yy9c2
   automatically matched to d1moxa1
   complexed with nag, ndg

Details for d1yy9a1

PDB Entry: 1yy9, 2.6 Å

PDB Description: structure of the extracellular domain of the epidermal growth factor receptor in complex with the fab fragment of cetuximab/erbitux/imc- c225

PDB Compounds: (A:) Epidermal growth factor receptor

SCOPe Domain Sequences for d1yy9a1:

Sequence; same for both SEQRES and ATOM records:

>d1yy9a1 c.10.2.5 (A:6-162) EGF receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
vcqgtsnkltqlgtfedhflslqrmfnncevvlgnleityvqrnydlsflktiqevagyv
lialntveriplenlqiirgnmyyensyalavlsnydanktglkelpmrnlqeilhgavr
fsnnpalcnvesiqwrdivssdflsnmsmdfqnhlgs

Timeline for d1yy9a1:

• d1yy9a1 first appeared in SCOP 1.73
  
• d1yy9a1 appears in SCOPe 2.06
  
• d1yy9a1 appears in the current release, SCOPe 2.08