SCOPe 2.06: Domain d1yxya1: 1yxy A:4-233

Lineage for d1yxya1 (1yxy A:4-233)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.5: NanE-like [117362] (1 protein)
   Pfam PF04131

6. Protein Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE [117363] (2 species)

7. Species Streptococcus pyogenes [TaxId:1314] [141754] (1 PDB entry)
   Uniprot P65522 4-233

8. Domain d1yxya1: 1yxy A:4-233 [124203]

Details for d1yxya1

PDB Entry: 1yxy, 1.6 Å

PDB Description: Crystal Structure of putative N-acetylmannosamine-6-P epimerase from Streptococcus pyogenes (APC29713) Structural genomics, MCSG

PDB Compounds: (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase

SCOPe Domain Sequences for d1yxya1:

Sequence; same for both SEQRES and ATOM records:

>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]}
kptkeklmeqlkggiivscqalpgeplysetggimplmakaaqeagavgiransvrdike
iqaitdlpiigiikkdyppqepfitatmtevdqlaalniaviamdctkrdrhdgldiasf
irqvkekypnqllmadistfdeglvahqagidfvgttlsgytpysrqeagpdvaliealc
kagiaviaegkihspeeakkindlgvagivvggaitrpkeiaerfiealk

Timeline for d1yxya1:

• d1yxya1 first appeared in SCOP 1.73
  
• d1yxya1 appears in SCOPe 2.05
  
• d1yxya1 appears in SCOPe 2.07
  
• d1yxya1 appears in the current release, SCOPe 2.08