SCOPe 2.08: Domain d1yxka_: 1yxk A:

Lineage for d1yxka_ (1yxk A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)

8. Domain d1yxka_: 1yxk A: [124189]
   automated match to d1hyra_

Details for d1yxka_

PDB Entry: 1yxk, 2.4 Å

PDB Description: Crystal structure of human lectin-like oxidized low-density lipoprotein receptor 1 (LOX-1) disulfide-linked dimer

PDB Compounds: (A:) oxidised low density lipoprotein (lectin-like) receptor 1

SCOPe Domain Sequences for d1yxka_:

Sequence; same for both SEQRES and ATOM records:

>d1yxka_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssf
pfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaa
fsicqkkanl

Timeline for d1yxka_:

• d1yxka_ first appeared in SCOP 1.73, called d1yxka1
  
• d1yxka_ appears in SCOPe 2.07