Lineage for d1yxja1 (1yxj A:143-270)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737894Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 737895Superfamily d.169.1: C-type lectin-like [56436] (8 families) (S)
  5. 737896Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
    Pfam PF00059
  6. 738127Protein Oxidised low density lipoprotein [143955] (1 species)
  7. 738128Species Human (Homo sapiens) [TaxId:9606] [143956] (5 PDB entries)
  8. 738131Domain d1yxja1: 1yxj A:143-270 [124187]
    automatically matched to 1YPQ A:140-270
    complexed with edo

Details for d1yxja1

PDB Entry: 1yxj (more details), 1.78 Å

PDB Description: Crystal structure of human lectin-like oxidized low-density lipoprotein receptor 1 (LOX-1) at low pH
PDB Compounds: (A:) oxidised low density lipoprotein (lectin-like) receptor 1

SCOP Domain Sequences for d1yxja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yxja1 d.169.1.1 (A:143-270) Oxidised low density lipoprotein {Human (Homo sapiens) [TaxId: 9606]}
pcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssfpf
wmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaafs
icqkkanl

SCOP Domain Coordinates for d1yxja1:

Click to download the PDB-style file with coordinates for d1yxja1.
(The format of our PDB-style files is described here.)

Timeline for d1yxja1: