Lineage for d1yxbc1 (1yxb C:4-91)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780087Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
    multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer
  4. 780088Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (4 families) (S)
    basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat
  5. 780130Family a.204.1.4: HisE-like (PRA-PH) [140797] (1 protein)
    Pfam PF01503
  6. 780131Protein Phosphoribosyl-ATP pyrophosphatase HisE [140798] (5 species)
  7. 780157Species Streptomyces coelicolor [TaxId:1902] [140799] (1 PDB entry)
    Uniprot Q9EWK0 4-91
  8. 780160Domain d1yxbc1: 1yxb C:4-91 [124177]
    automatically matched to 1YXB A:4-91

Details for d1yxbc1

PDB Entry: 1yxb (more details), 2.6 Å

PDB Description: Crystal structure of Phosphoribosyl-ATP pyrophosphatase from Streptomyces coelicolor. NESG target RR8.
PDB Compounds: (C:) Phosphoribosyl-ATP pyrophosphatase

SCOP Domain Sequences for d1yxbc1:

Sequence, based on SEQRES records: (download)

>d1yxbc1 a.204.1.4 (C:4-91) Phosphoribosyl-ATP pyrophosphatase HisE {Streptomyces coelicolor [TaxId: 1902]}
ktfeelftelqhkaangdpatsrtaelvdkgvhaigkkvveeaaevwmaaeyegkdaaae
eisqllyhvqvmmvargislddvyahll

Sequence, based on observed residues (ATOM records): (download)

>d1yxbc1 a.204.1.4 (C:4-91) Phosphoribosyl-ATP pyrophosphatase HisE {Streptomyces coelicolor [TaxId: 1902]}
ktfeelftelqhkaantsrtaelvdkgvhaigkkvveeaaevwmaaeyegkdaaaeeisq
llyhvqvmmvargislddvyahll

SCOP Domain Coordinates for d1yxbc1:

Click to download the PDB-style file with coordinates for d1yxbc1.
(The format of our PDB-style files is described here.)

Timeline for d1yxbc1: