Lineage for d1ywke1 (1ywk E:1001-1260)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809734Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 809735Superfamily b.82.1: RmlC-like cupins [51182] (24 families) (S)
  5. 810060Family b.82.1.13: KduI-like [110318] (1 protein)
    Pfam PF04962: duplication: consists of two germin-like domains
  6. 810061Protein 5-keto-4-deoxyuronate isomerase KduI [110319] (2 species)
  7. 810062Species Enterococcus faecalis [TaxId:1351] [141602] (1 PDB entry)
    Uniprot Q838L9 1-260
  8. 810067Domain d1ywke1: 1ywk E:1001-1260 [124159]
    automatically matched to 1YWK A:1001-1260

Details for d1ywke1

PDB Entry: 1ywk (more details), 2.95 Å

PDB Description: Crystal structure of 4-deoxy-1-threo-5-hexosulose-uronate ketol-isomerase from Enterococcus faecalis
PDB Compounds: (E:) 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase 1

SCOP Domain Sequences for d1ywke1:

Sequence, based on SEQRES records: (download)

>d1ywke1 b.82.1.13 (E:1001-1260) 5-keto-4-deoxyuronate isomerase KduI {Enterococcus faecalis [TaxId: 1351]}
metrythspadirhysteqlrdeflvekvfipgaisltythndrmifggvtptteeleii
ldkelgvdyflerrelgviniggpgfieidgaketmkkqdgyyigketkhvrfssenpdn
pakfyiscvpahhkypnvkisideitpmetgdpltlnqrkiyqyihpnvcescqlqmgyt
ilepgsawntmpchtherrmeayvyfdmeedtrifhmmgkpdetkhlvmsneqaaispsw
sihsgvgtsnysfiwamcge

Sequence, based on observed residues (ATOM records): (download)

>d1ywke1 b.82.1.13 (E:1001-1260) 5-keto-4-deoxyuronate isomerase KduI {Enterococcus faecalis [TaxId: 1351]}
metrythspadirhysteqlrdeflvekvfipgaisltythndrmifggvtptteeleii
ldkelgvdyflerrelgviniggpgfieidgaketmkkqdgyyigketkhvrfssenpdn
pakfyiscvpahhkypnvkisideitpmetgdpltlnqrkiyqyihpnvcescqlqmgyt
ilepgsawntmeayvyfdmeedtrifhmmgkpdetkhlvmsneqaaispswsihsgvgts
nysfiwamcge

SCOP Domain Coordinates for d1ywke1:

Click to download the PDB-style file with coordinates for d1ywke1.
(The format of our PDB-style files is described here.)

Timeline for d1ywke1: