SCOPe 2.07: Domain d1yvtb_: 1yvt B:

Lineage for d1yvtb_ (1yvt B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (26 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46501] (284 PDB entries)
   Uniprot P68871

8. Domain d1yvtb_: 1yvt B: [124119]
   Other proteins in same PDB: d1yvta_
   automated match to d1nqpb_
   complexed with cmo, gol, hem

Details for d1yvtb_

PDB Entry: 1yvt, 1.8 Å

PDB Description: the high salt (phosphate) crystal structure of co hemoglobin e (glu26lys) at physiological ph (ph 7.35)

PDB Compounds: (B:) hemoglobin beta chain

SCOPe Domain Sequences for d1yvtb_:

Sequence; same for both SEQRES and ATOM records:

>d1yvtb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
vhltpeeksavtalwgkvnvdevggkalgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

Timeline for d1yvtb_:

• d1yvtb_ first appeared in SCOP 1.73, called d1yvtb1
  
• d1yvtb_ appears in SCOPe 2.06
  
• d1yvtb_ appears in the current release, SCOPe 2.08