SCOP 1.75: Domain d1yvqb1: 1yvq B:1-146

Lineage for d1yvqb1 (1yvq B:1-146)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46501] (177 PDB entries)
   Uniprot P68871

8. Domain d1yvqb1: 1yvq B:1-146 [124113]
   Other proteins in same PDB: d1yvqa1, d1yvqc1
   automatically matched to d1nqpb_
   complexed with cmo, hem; mutant

Details for d1yvqb1

PDB Entry: 1yvq, 1.8 Å

PDB Description: the low salt (peg) crystal structure of co hemoglobin e (betae26k) approaching physiological ph (ph 7.5)

PDB Compounds: (B:) hemoglobin beta chain

SCOP Domain Sequences for d1yvqb1:

Sequence; same for both SEQRES and ATOM records:

>d1yvqb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
vhltpeeksavtalwgkvnvdevggkalgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

Timeline for d1yvqb1:

• d1yvqb1 first appeared in SCOP 1.73
  
• d1yvqb1 is called d1yvqb_ in SCOPe 2.01
  
• d1yvqb1 appears in the current release, SCOPe 2.08, called d1yvqb_