Lineage for d1yv1b1 (1yv1 B:1-166)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766020Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 766579Protein Nigerythrin, N-terminal domain [140440] (1 species)
  7. 766580Species Desulfovibrio vulgaris [TaxId:881] [140441] (3 PDB entries)
    Uniprot P30820 1-166
  8. 766584Domain d1yv1b1: 1yv1 B:1-166 [124086]
    Other proteins in same PDB: d1yv1a2, d1yv1b2
    automatically matched to 1YUX A:1-166
    complexed with fe2; mutant

Details for d1yv1b1

PDB Entry: 1yv1 (more details), 1.5 Å

PDB Description: Fully reduced state of nigerythrin (all ferrous)
PDB Compounds: (B:) Nigerythrin

SCOP Domain Sequences for d1yv1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yv1b1 a.25.1.1 (B:1-166) Nigerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}
mkvraqvptvknatnfnmvadsktsvgstlenlkaaiagetgahakytafakaareqgye
qiarlfeataaaelihigleyalvaemepgyekptvaapsayscdlnlisgangeiyets
dmypafirkaqeegnskavhvftraklaesvhaerylaayndidap

SCOP Domain Coordinates for d1yv1b1:

Click to download the PDB-style file with coordinates for d1yv1b1.
(The format of our PDB-style files is described here.)

Timeline for d1yv1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yv1b2