SCOPe 2.07: Domain d1yuzb1: 1yuz B:23-157

Lineage for d1yuzb1 (1yuz B:23-157)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein Nigerythrin, N-terminal domain [140440] (1 species)

7. Species Desulfovibrio vulgaris [TaxId:881] [140441] (3 PDB entries)
   Uniprot P30820 1-166

8. Domain d1yuzb1: 1yuz B:23-157 [124079]
   Other proteins in same PDB: d1yuza2, d1yuzb2
   automatically matched to 1YUZ A:23-157
   complexed with fe, fe2

Details for d1yuzb1

PDB Entry: 1yuz, 1.4 Å

PDB Description: Partially Reduced State of Nigerythrin

PDB Compounds: (B:) Nigerythrin

SCOPe Domain Sequences for d1yuzb1:

Sequence; same for both SEQRES and ATOM records:

>d1yuzb1 a.25.1.1 (B:23-157) Nigerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}
ktavgstlenlkaaiagetgahakytafakaareqgyeqiarlfeataaaelihigleya
lvaemepgyekptvaapsayscdlnlisgangeiyetsdmypafirkaqeegnskavhvf
traklaesvhaeryl

Timeline for d1yuzb1:

• d1yuzb1 first appeared in SCOP 1.73
  
• d1yuzb1 appears in SCOPe 2.06
  
• d1yuzb1 appears in the current release, SCOPe 2.08