Lineage for d1yuza1 (1yuz A:23-157)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2315275Protein Nigerythrin, N-terminal domain [140440] (1 species)
  7. 2315276Species Desulfovibrio vulgaris [TaxId:881] [140441] (3 PDB entries)
    Uniprot P30820 1-166
  8. 2315277Domain d1yuza1: 1yuz A:23-157 [124077]
    Other proteins in same PDB: d1yuza2, d1yuzb2
    complexed with fe, fe2

Details for d1yuza1

PDB Entry: 1yuz (more details), 1.4 Å

PDB Description: Partially Reduced State of Nigerythrin
PDB Compounds: (A:) Nigerythrin

SCOPe Domain Sequences for d1yuza1:

Sequence, based on SEQRES records: (download)

>d1yuza1 a.25.1.1 (A:23-157) Nigerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}
ktavgstlenlkaaiagetgahakytafakaareqgyeqiarlfeataaaelihigleya
lvaemepgyekptvaapsayscdlnlisgangeiyetsdmypafirkaqeegnskavhvf
traklaesvhaeryl

Sequence, based on observed residues (ATOM records): (download)

>d1yuza1 a.25.1.1 (A:23-157) Nigerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}
ktavgstlenlkaaiagetgahakytafakaareqgyeqiarlfeataaaelihigleya
lvaemepgyekptvpsayscdlnlisgangeiyetsdmypafirkaqeegnskavhvftr
aklaesvhaeryl

SCOPe Domain Coordinates for d1yuza1:

Click to download the PDB-style file with coordinates for d1yuza1.
(The format of our PDB-style files is described here.)

Timeline for d1yuza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yuza2