SCOP 1.75: Domain d1yura1: 1yur A:1-98

Lineage for d1yura1 (1yur A:1-98)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (1 protein)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (17 species)

7. Species Human (Homo sapiens), s100a13 [TaxId:9606] [140535] (4 PDB entries)
   Uniprot Q99584 1-98

8. Domain d1yura1: 1yur A:1-98 [124062]

Details for d1yura1

PDB Entry: 1yur

PDB Description: solution structure of apo-s100a13 (minimized mean structure)

PDB Compounds: (A:) S100 calcium-binding protein A13

SCOP Domain Sequences for d1yura1:

Sequence; same for both SEQRES and ATOM records:

>d1yura1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]}
maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
ksldvnqdselkfneywrligelakeirkkkdlkirkk

Timeline for d1yura1:

• d1yura1 first appeared in SCOP 1.73
  
• d1yura1 appears in SCOPe 2.01
  
• d1yura1 appears in the current release, SCOPe 2.08