Lineage for d1yu5x1 (1yu5 X:10-76)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764597Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily)
    3 short helices; irregular array
  4. 764598Superfamily a.14.1: VHP, Villin headpiece domain [47050] (1 family) (S)
  5. 764599Family a.14.1.1: VHP, Villin headpiece domain [47051] (4 proteins)
  6. 764609Protein Villin [47052] (2 species)
  7. 764610Species Chicken (Gallus gallus) [TaxId:9031] [47053] (6 PDB entries)
  8. 764611Domain d1yu5x1: 1yu5 X:10-76 [124039]
    automatically matched to d1qqva_

Details for d1yu5x1

PDB Entry: 1yu5 (more details), 1.4 Å

PDB Description: Crystal Structure of the Headpiece Domain of Chicken Villin
PDB Compounds: (X:) villin

SCOP Domain Sequences for d1yu5x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yu5x1 a.14.1.1 (X:10-76) Villin {Chicken (Gallus gallus) [TaxId: 9031]}
ptkletfpldvlvntaaedlprgvdpsrkenhlsdedfkavfgmtrsafanlplwkqqnl
kkekglf

SCOP Domain Coordinates for d1yu5x1:

Click to download the PDB-style file with coordinates for d1yu5x1.
(The format of our PDB-style files is described here.)

Timeline for d1yu5x1: