Lineage for d1yu4b2 (1yu4 B:171-380)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2235396Family d.169.1.8: Mtd variable domain [143964] (1 protein)
    fold decorated with many additional structures; overall similarity to the Sulfatase modifying factor family; lacks the characteristic disulfide
  6. 2235397Protein Major tropism determinant (Mtd), C-terminal domain [143965] (1 species)
  7. 2235398Species Bordetella phage bpp-1 [TaxId:194699] [143966] (6 PDB entries)
    Uniprot Q775D6 171-380
    includes related Bordetella phage proteins
  8. 2235402Domain d1yu4b2: 1yu4 B:171-380 [124036]
    Other proteins in same PDB: d1yu4a1, d1yu4b1, d1yu4c1
    automated match to d1yu4a2
    complexed with mg

Details for d1yu4b2

PDB Entry: 1yu4 (more details), 1.87 Å

PDB Description: Major Tropism Determinant U1 Variant
PDB Compounds: (B:) Major Tropism Determinant (Mtd-U1)

SCOPe Domain Sequences for d1yu4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yu4b2 d.169.1.8 (B:171-380) Major tropism determinant (Mtd), C-terminal domain {Bordetella phage bpp-1 [TaxId: 194699]}
kfrpaaldprgmtlvagafwadiyllgvnhltdgtskynvtiadgsaspkkstkfggdgs
aaysdgawynfaevmthhgkrlpnynefqalafgtteatssggtdvpttgvngtgatsaw
niftskwgvvqasgclwtwgnefggvngaseytantggrgsvyaqpaaalfggnwnstsn
sgsraanwnsgpsnspanigargvcdhlil

SCOPe Domain Coordinates for d1yu4b2:

Click to download the PDB-style file with coordinates for d1yu4b2.
(The format of our PDB-style files is described here.)

Timeline for d1yu4b2: