SCOPe 2.06: Domain d1yu3a1: 1yu3 A:5-170

Lineage for d1yu3a1 (1yu3 A:5-170)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.163: Pseudo beta-prism I [141657] (1 superfamily)
   beta-sandwich with one regular beta-sheet and the other beta-sheet bent in the middle with a set of aligned beta-bulges

4. Superfamily b.163.1: Bacteriophage trimeric proteins domain [141658] (2 families)
   found in phage proteins that form trimers, but is not involved in the trimerisation

5. Family b.163.1.1: Mtd domain-like [141659] (1 protein)

6. Protein Major tropism determinant (Mtd), N-terminal domain [141660] (1 species)
   includes extra N-terminal trimerization domain; beta-alpha-beta(3)

7. Species Bordetella phage bpp-1 [TaxId:194699] [141661] (6 PDB entries)
   Uniprot Q775D6 5-170
   includes other related Bordetella phages

8. Domain d1yu3a1: 1yu3 A:5-170 [124031]
   Other proteins in same PDB: d1yu3a2
   complexed with mg

Details for d1yu3a1

PDB Entry: 1yu3, 2.52 Å

PDB Description: Major Tropism Determinant I1 Variant

PDB Compounds: (A:) Major Tropism Determinant (Mtd-I1)

SCOPe Domain Sequences for d1yu3a1:

Sequence; same for both SEQRES and ATOM records:

>d1yu3a1 b.163.1.1 (A:5-170) Major tropism determinant (Mtd), N-terminal domain {Bordetella phage bpp-1 [TaxId: 194699]}
vqfrggttaqhatftgaareitvdtdkntvvvhdgataggfplarhdlvktafikadksa
vaftrtgnatasikagtivevngklvqftadtaitmpaltagtdyaiyvcddgtvradsn
fsaptgytsttarkvggfhyapgsnaaaqaggnttaqineyslwdi

Timeline for d1yu3a1:

• d1yu3a1 first appeared in SCOP 1.73
  
• d1yu3a1 appears in SCOPe 2.05
  
• d1yu3a1 appears in SCOPe 2.07
  
• d1yu3a1 appears in the current release, SCOPe 2.08