Lineage for d1ytzt1 (1ytz T:159-248)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2265467Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2266671Superfamily h.1.25: Troponin coil-coiled subunits [90250] (2 families) (S)
    form heterodimeric coiled coil
  5. 2266672Family h.1.25.1: Troponin T [90251] (1 protein)
  6. 2266673Protein Troponin T [90252] (2 species)
  7. 2266674Species Chicken (Gallus gallus) [TaxId:9031] [144262] (2 PDB entries)
    Uniprot P12620 159-248
  8. 2266675Domain d1ytzt1: 1ytz T:159-248 [124024]
    Other proteins in same PDB: d1ytzc_, d1ytzi1
    complexed with ca, dr6

Details for d1ytzt1

PDB Entry: 1ytz (more details), 3 Å

PDB Description: crystal structure of skeletal muscle troponin in the ca2+-activated state
PDB Compounds: (T:) Troponin T

SCOPe Domain Sequences for d1ytzt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytzt1 h.1.25.1 (T:159-248) Troponin T {Chicken (Gallus gallus) [TaxId: 9031]}
syssylakadqkrgkkqtaretkkkvlaerrkplnidhlnedklrdkakelwdwlyqlqt
ekydfaeqikrkkyeivtlrnridqaqkhs

SCOPe Domain Coordinates for d1ytzt1:

Click to download the PDB-style file with coordinates for d1ytzt1.
(The format of our PDB-style files is described here.)

Timeline for d1ytzt1: