SCOPe 2.04: Domain d1ysxa1: 1ysx A:389-584

Lineage for d1ysxa1 (1ysx A:389-584)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (69 PDB entries)
   Uniprot P02768 29-596

8. Domain d1ysxa1: 1ysx A:389-584 [123985]
   automatically matched to d1bj5_3
   complexed with 4eb

Details for d1ysxa1

PDB Entry: 1ysx

PDB Description: solution structure of domain 3 from human serum albumin complexed to an anti-apoptotic ligand directed against bcl-xl and bcl-2

PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d1ysxa1:

Sequence; same for both SEQRES and ATOM records:

>d1ysxa1 a.126.1.1 (A:389-584) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasqaalg

Timeline for d1ysxa1:

• d1ysxa1 first appeared in SCOP 1.73
  
• d1ysxa1 appears in SCOPe 2.03
  
• d1ysxa1 appears in SCOPe 2.05
  
• d1ysxa1 appears in the current release, SCOPe 2.08