Lineage for d1ysea1 (1yse A:368-455)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640241Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 640242Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) (S)
  5. 640478Family a.35.1.7: CUT domain [116891] (4 proteins)
    Pfam PF02376
  6. 640479Protein DNA-binding protein SATB1 [140518] (1 species)
  7. 640480Species Human (Homo sapiens) [TaxId:9606] [140519] (1 PDB entry)
  8. 640481Domain d1ysea1: 1yse A:368-455 [123970]
    1st CUT domain

Details for d1ysea1

PDB Entry: 1yse (more details)

PDB Description: solution structure of the mar-binding domain of satb1
PDB Compounds: (A:) DNA-binding protein SATB1

SCOP Domain Sequences for d1ysea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ysea1 a.35.1.7 (A:368-455) DNA-binding protein SATB1 {Human (Homo sapiens) [TaxId: 9606]}
ntevsseiyqwvrdelkragisqavfarvafnrtqgllseilrkeedpktasqsllvnlr
amqnflqlpeaerdriyqdererslnaa

SCOP Domain Coordinates for d1ysea1:

Click to download the PDB-style file with coordinates for d1ysea1.
(The format of our PDB-style files is described here.)

Timeline for d1ysea1: