Lineage for d1yrrb1 (1yrr B:1-53,B:351-382)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 811542Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 811543Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 811673Family b.92.1.5: N-acetylglucosamine-6-phosphate deacetylase, NagA [82227] (1 protein)
  6. 811674Protein N-acetylglucosamine-6-phosphate deacetylase, NagA [82228] (3 species)
  7. 811678Species Escherichia coli [TaxId:562] [141688] (4 PDB entries)
    Uniprot P0AF18 1-53,351-382
  8. 811680Domain d1yrrb1: 1yrr B:1-53,B:351-382 [123937]
    Other proteins in same PDB: d1yrra2, d1yrrb2
    automatically matched to 1YMY A:1-53,A:351-382
    complexed with gol, po4

Details for d1yrrb1

PDB Entry: 1yrr (more details), 2 Å

PDB Description: Crystal Structure Of The N-Acetylglucosamine-6-Phosphate Deacetylase From Escherichia Coli K12 at 2.0 A Resolution
PDB Compounds: (B:) N-acetylglucosamine-6-phosphate deacetylase

SCOP Domain Sequences for d1yrrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yrrb1 b.92.1.5 (B:1-53,B:351-382) N-acetylglucosamine-6-phosphate deacetylase, NagA {Escherichia coli [TaxId: 562]}
myaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspXtlaagk
vanltaftpdfkitktivngnevvtq

SCOP Domain Coordinates for d1yrrb1:

Click to download the PDB-style file with coordinates for d1yrrb1.
(The format of our PDB-style files is described here.)

Timeline for d1yrrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yrrb2