SCOPe 2.08: Domain d1yrra1: 1yrr A:1-53,A:351-382

Lineage for d1yrra1 (1yrr A:1-53,A:351-382)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.5: N-acetylglucosamine-6-phosphate deacetylase, NagA [82227] (1 protein)

6. Protein N-acetylglucosamine-6-phosphate deacetylase, NagA [82228] (3 species)

7. Species Escherichia coli [TaxId:562] [141688] (4 PDB entries)
   Uniprot P0AF18 1-53,351-382

8. Domain d1yrra1: 1yrr A:1-53,A:351-382 [123935]
   Other proteins in same PDB: d1yrra2, d1yrrb2
   automated match to d1ymya1
   complexed with gol, po4

Details for d1yrra1

PDB Entry: 1yrr, 2 Å

PDB Description: Crystal Structure Of The N-Acetylglucosamine-6-Phosphate Deacetylase From Escherichia Coli K12 at 2.0 A Resolution

PDB Compounds: (A:) N-acetylglucosamine-6-phosphate deacetylase

SCOPe Domain Sequences for d1yrra1:

Sequence; same for both SEQRES and ATOM records:

>d1yrra1 b.92.1.5 (A:1-53,A:351-382) N-acetylglucosamine-6-phosphate deacetylase, NagA {Escherichia coli [TaxId: 562]}
myaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspXtlaagk
vanltaftpdfkitktivngnevvtq

Timeline for d1yrra1:

• d1yrra1 first appeared in SCOP 1.73
  
• d1yrra1 appears in SCOPe 2.07