SCOPe 2.01: Domain d1yqvl1: 1yqv L:2-107

Lineage for d1yqvl1 (1yqv L:2-107)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (44 PDB entries)
   Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1

8. Domain d1yqvl1: 1yqv L:2-107 [123900]
   Other proteins in same PDB: d1yqvh1, d1yqvl2, d1yqvy1
   automatically matched to d1eo8l1

Details for d1yqvl1

PDB Entry: 1yqv, 1.7 Å

PDB Description: the crystal structure of the antibody fab hyhel5 complex with lysozyme at 1.7a resolution

PDB Compounds: (L:) HyHEL-5 Antibody Light Chain

SCOPe Domain Sequences for d1yqvl1:

Sequence; same for both SEQRES and ATOM records:

>d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
ivltqspaimsaspgekvtmtcsasssvnymywyqqksgtspkrwiydtsklasgvpvrf
sgsgsgtsysltissmetedaatyycqqwgrnptfgggtkleik

Timeline for d1yqvl1:

• d1yqvl1 first appeared in SCOP 1.73
  
• d1yqvl1 appears in SCOP 1.75
  
• d1yqvl1 appears in SCOPe 2.02
  
• d1yqvl1 appears in the current release, SCOPe 2.08