Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein automated matches [190161] (29 species) not a true protein |
Species Streptomyces sp. [TaxId:31952] [186885] (1 PDB entry) |
Domain d1yqsa_: 1yqs A: [123899] automated match to d1cef__ complexed with bsa, gol |
PDB Entry: 1yqs (more details), 1.05 Å
SCOPe Domain Sequences for d1yqsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yqsa_ e.3.1.1 (A:) automated matches {Streptomyces sp. [TaxId: 31952]} lpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrvgs vtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmfaq tvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsvate yqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagavis stqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtgtv qgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkp
Timeline for d1yqsa_: