Lineage for d1yqsa_ (1yqs A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013567Protein automated matches [190161] (29 species)
    not a true protein
  7. 3014000Species Streptomyces sp. [TaxId:31952] [186885] (1 PDB entry)
  8. 3014001Domain d1yqsa_: 1yqs A: [123899]
    automated match to d1cef__
    complexed with bsa, gol

Details for d1yqsa_

PDB Entry: 1yqs (more details), 1.05 Å

PDB Description: Inhibition of the R61 DD-Peptidase by N-benzoyl-beta-sultam
PDB Compounds: (A:) d-alanyl-d-alanine carboxypeptidase

SCOPe Domain Sequences for d1yqsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yqsa_ e.3.1.1 (A:) automated matches {Streptomyces sp. [TaxId: 31952]}
lpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrvgs
vtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmfaq
tvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsvate
yqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagavis
stqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtgtv
qgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkp

SCOPe Domain Coordinates for d1yqsa_:

Click to download the PDB-style file with coordinates for d1yqsa_.
(The format of our PDB-style files is described here.)

Timeline for d1yqsa_: