Lineage for d1yq2d5 (1yq2 D:313-609)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1145288Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1145755Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1145839Protein beta-Galactosidase, domain 3 [51510] (2 species)
  7. 1145840Species Arthrobacter sp. c2-2 [TaxId:192168] [141778] (1 PDB entry)
    Uniprot Q8KRF6 313-609
  8. 1145844Domain d1yq2d5: 1yq2 D:313-609 [123862]
    Other proteins in same PDB: d1yq2a1, d1yq2a2, d1yq2a3, d1yq2a4, d1yq2b1, d1yq2b2, d1yq2b3, d1yq2b4, d1yq2c1, d1yq2c2, d1yq2c3, d1yq2c4, d1yq2d1, d1yq2d2, d1yq2d3, d1yq2d4, d1yq2e1, d1yq2e2, d1yq2e3, d1yq2e4, d1yq2f1, d1yq2f2, d1yq2f3, d1yq2f4
    automatically matched to 1YQ2 A:313-609
    complexed with cl, mg, na, peg, so4

Details for d1yq2d5

PDB Entry: 1yq2 (more details), 1.9 Å

PDB Description: beta-galactosidase from arthrobacter sp. c2-2 (isoenzyme c2-2-1)
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d1yq2d5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yq2d5 c.1.8.3 (D:313-609) beta-Galactosidase, domain 3 {Arthrobacter sp. c2-2 [TaxId: 192168]}
vrivgdqflvngrrvvfhgvnrhethpdrgrvfdeagaredlalmkrfnvnairtshypp
hprlldlademgfwvilecdlethgfeaggwvenpsdvpawrdalvdrmertverdknhp
sivmwslgnesgtgsnlaamaawahardssrpvhyegdytgaytdvysrmyssipetdsi
grndshalllgcdsaesarqrtkpfilceyvhamgngpgamdqyealvdkyprlhggfvw
ewrdhgirtrtaegmeffayggdfgevvhdsnfvmdgmvlsdstptpglyefkqivs

SCOPe Domain Coordinates for d1yq2d5:

Click to download the PDB-style file with coordinates for d1yq2d5.
(The format of our PDB-style files is described here.)

Timeline for d1yq2d5: