Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) |
Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
Protein beta-Galactosidase [49804] (2 species) |
Species Arthrobacter sp. c2-2 [TaxId:192168] [141112] (1 PDB entry) Uniprot Q8KRF6 4-219 |
Domain d1yq2c3: 1yq2 C:4-219 [123855] Other proteins in same PDB: d1yq2a1, d1yq2a2, d1yq2a4, d1yq2a5, d1yq2b1, d1yq2b2, d1yq2b4, d1yq2b5, d1yq2c1, d1yq2c2, d1yq2c4, d1yq2c5, d1yq2d1, d1yq2d2, d1yq2d4, d1yq2d5, d1yq2e1, d1yq2e2, d1yq2e4, d1yq2e5, d1yq2f1, d1yq2f2, d1yq2f4, d1yq2f5 automated match to d1yq2a3 complexed with cl, mg, na, peg, so4 |
PDB Entry: 1yq2 (more details), 1.9 Å
SCOPe Domain Sequences for d1yq2c3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yq2c3 b.18.1.5 (C:4-219) beta-Galactosidase {Arthrobacter sp. c2-2 [TaxId: 192168]} advsyltdqgpgsgrrvparswlhsdapalslngdwrfrllpaapgtagagsvlpsgetv egvaaesyddaawdtlpvpshwvmgqdgkygrpiytnvqypfpidpphvpdanptgdfrr rfdvpaqwfesttaaltlrfdgvesrykvwvngqeigvgsgsrlaqefdvsdalragsnl lvvrvhqwsaasyledqdqwwlpgifrdvtlqarpa
Timeline for d1yq2c3:
View in 3D Domains from same chain: (mouse over for more information) d1yq2c1, d1yq2c2, d1yq2c4, d1yq2c5 |