SCOPe 2.07: Domain d1ypzc1: 1ypz C:181-276

Lineage for d1ypzc1 (1ypz C:181-276)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC homolog, alpha-3 domain [88610] (4 species)
   gamma, delta T-cell ligand

7. Species Mouse (Mus musculus), t22 [TaxId:10090] [88611] (2 PDB entries)

8. Domain d1ypzc1: 1ypz C:181-276 [123840]
   Other proteins in same PDB: d1ypza2, d1ypzb1, d1ypzc2, d1ypzd1, d1ypze1, d1ypze2, d1ypzf1, d1ypzf2, d1ypzg1, d1ypzg2, d1ypzh1, d1ypzh2
   automatically matched to d1c16a1

Details for d1ypzc1

PDB Entry: 1ypz, 3.4 Å

PDB Description: immune receptor

PDB Compounds: (C:) H2-T22 protein

SCOPe Domain Sequences for d1ypzc1:

Sequence; same for both SEQRES and ATOM records:

>d1ypzc1 b.1.1.2 (C:181-276) Class I MHC homolog, alpha-3 domain {Mouse (Mus musculus), t22 [TaxId: 10090]}
rsdppkahvtrhprpegdvtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
fqkwaavvvplgkeqsytchvyheglpeplilrwgg

Timeline for d1ypzc1:

• d1ypzc1 first appeared in SCOP 1.73
  
• d1ypzc1 appears in SCOPe 2.06
  
• d1ypzc1 appears in the current release, SCOPe 2.08