Lineage for d1ypza1 (1ypz A:181-276)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1106681Protein Class I MHC homolog, alpha-3 domain [88610] (4 species)
    gamma, delta T-cell ligand
  7. 1106692Species Mouse (Mus musculus), t22 [TaxId:10090] [88611] (2 PDB entries)
  8. 1106697Domain d1ypza1: 1ypz A:181-276 [123837]
    Other proteins in same PDB: d1ypza2, d1ypzb1, d1ypzc2, d1ypzd1, d1ypze1, d1ypze2, d1ypzf1, d1ypzf2, d1ypzg1, d1ypzg2, d1ypzh1, d1ypzh2
    automatically matched to d1c16a1

Details for d1ypza1

PDB Entry: 1ypz (more details), 3.4 Å

PDB Description: Immune receptor
PDB Compounds: (A:) H2-T22 protein

SCOPe Domain Sequences for d1ypza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ypza1 b.1.1.2 (A:181-276) Class I MHC homolog, alpha-3 domain {Mouse (Mus musculus), t22 [TaxId: 10090]}
rsdppkahvtrhprpegdvtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
fqkwaavvvplgkeqsytchvyheglpeplilrwgg

SCOPe Domain Coordinates for d1ypza1:

Click to download the PDB-style file with coordinates for d1ypza1.
(The format of our PDB-style files is described here.)

Timeline for d1ypza1: