SCOPe 2.02: Domain d1ypub_: 1ypu B:

Lineage for d1ypub_ (1ypu B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (17 PDB entries)

8. Domain d1ypub_: 1ypu B: [123836]
   automated match to d1hyra_

Details for d1ypub_

PDB Entry: 1ypu, 2.05 Å

PDB Description: Human Oxidized Low Density Lipoprotein Receptor LOX-1 C2 Space Group

PDB Compounds: (B:) oxidised low density lipoprotein (lectin-like) receptor 1

SCOPe Domain Sequences for d1ypub_:

Sequence; same for both SEQRES and ATOM records:

>d1ypub_ d.169.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rvancsapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqai
syssfpfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaen
cilaafsicqkkanl

Timeline for d1ypub_:

• d1ypub_ first appeared in SCOP 1.73, called d1ypub1
  
• d1ypub_ appears in SCOPe 2.01
  
• d1ypub_ appears in SCOPe 2.03
  
• d1ypub_ appears in the current release, SCOPe 2.08